PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do019630.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family MYB
Protein Properties Length: 245aa    MW: 28410.1 Da    PI: 7.417
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do019630.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.51.3e-171562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT  Ed ll ++v+q+G g+W+++a+  g++R++k+c++rw +yl
       Do019630.1 15 KGPWTSLEDRLLTEYVQQHGEGSWNSVAKLTGLRRSGKSCRLRWVNYL 62
                     79********************************************97 PP

2Myb_DNA-binding48.52e-1568115147
                      TSSS-HHHHHHHHHHHHHTTTT..-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGgg..tWktIartmgkgRtlkqcksrwqky 47 
                      rg+ T++E+  +++++++lG++   W++Iar+++ gRt++++k++w+++
       Do019630.1  68 RGKITPDEETVILQLHAMLGNRycPWSAIARCLP-GRTDNEIKNYWRTH 115
                      8999******************************.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.4391062IPR017930Myb domain
SuperFamilySSF466891.61E-2812112IPR009057Homeodomain-like
SMARTSM007172.1E-141464IPR001005SANT/Myb domain
PfamPF002492.1E-161562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.1E-231669IPR009057Homeodomain-like
CDDcd001674.83E-101762No hitNo description
PROSITE profilePS5129422.06763120IPR017930Myb domain
SMARTSM007171.1E-1167118IPR001005SANT/Myb domain
PfamPF002494.6E-1368115IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.8E-2270118IPR009057Homeodomain-like
CDDcd001673.47E-972116No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 245 aa     Download sequence    Send to blast
MDAISSQMLQ EGWRKGPWTS LEDRLLTEYV QQHGEGSWNS VAKLTGLRRS GKSCRLRWVN  60
YLRPDLKRGK ITPDEETVIL QLHAMLGNRY CPWSAIARCL PGRTDNEIKN YWRTHFKKAR  120
PSRRARAQLL HQYQLQQQEQ RRQYLQSLQL LQQQQQQMQL LQQQNHQELM MVKQQQEQQS  180
PPEPDHQAVM TAMMNNLQCP ECYCSPASTA EHCTLPDDDD ALLWDSLWKL VDGDGCGDGS  240
SGGEC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-251511827126MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9604501e-175EU960450.1 Zea mays clone 224989 MYB305 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004985745.11e-117PREDICTED: protein ODORANT1-like
TrEMBLK4AEH41e-117K4AEH4_SETIT; Uncharacterized protein
STRINGSi037281m1e-116(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP132282433
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24310.14e-60myb domain protein 305